Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

The BigStacks narrow profile takes up the least amount of rooftop space and carries up to four (4) boats on their sides. Its padded to protect your boat and vehicle and the steel reinformced arms fold down when not in use.Four boat capacity in a small package.New SteelCore construction uses a steel substrate encase in durbale foam padding.Folds down flat when not in use for the ultimate in rooftop clearance. Hullguard pads protect and keep your boat looking brand new.Locks to crossbar with SKS systems (SKS lock cores not included).AnchorHead tie-down feature offers improved strap managementIncludes 1 pair of Heady Duty Straps with padded bucklesIncludes Bow/Stern Ttie-down straps to complete kayak stabilityFits round, square and most factory crossbars out of the box.New, never used, still in box.See pix below.Call 702-293-7077 for more information. Location: Las Vegas areaits NOT ok to contact this poster with services or other commercial interests

Location: SW LAS VEGASits NOT ok to contact this poster with services or other commercial interests

asking $850.00 or best offer702-809-0757 ask for JONONLY SERIOUS INQUIRIES PLEASE !!!!! Location: las vegasits NOT ok to contact this poster with services or other commercial interests

Post images in classifieds  Location: west vegasits NOT ok to contact this poster with services or other commercial interests

It is $ 180 Each obo I have a 26 oz and a 27 oz. I prefer not to ship. Interested individuals shall be locally in the Las Vegas Area. Interested buyers please email me your name and phone # so we can make arrangements. Emails with no contact info will be disregarded. Email - phatazn2envy@yahoo.com Thanks for Looking Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

Location: E. Las Vegasits NOT ok to contact this poster with services or other commercial interests

8 X 21 Binoculars,Made by SIMMONS,Comes with Pleather case (case can be weaved through belt). Has cord to hand around neck and fold inward to be more compact! Was part of the Marlboro Adventure Team promos. **Used pair and new..New- never touched pair-$8 for both. ****** Call #702-502-0474. If interested in purchasing.... Location: LasVegasits NOT ok to contact this poster with services or other commercial interests

Have lots of fishing equipment for sale, starting at $0.50 to $10.00Price: Most items from $0.50 to $2.00Over 1000 items for your choiceFISHING POLE: $10.00 eachHUNDREDS FISHING MAGAZINE AT $1.00 each- BASS from 2002-2009- FLW from 2000-2009- BASS WEST few yearsRenny(702) 403-2340Sunday, Monday: All dayTuesday through Saturday: after 1:30pm Location: NORTH LAS VEGASits NOT ok to contact this poster with services or other commercial interests

Most of it has been cleaned and serviced. I also have Factory refurbished equipment also which comes with a factory warranty! They have all been lightly used in gyms and training studios. We bring them in and clean and service them. We also replace anything on the unit that needs to be replaced. Its as good as brand new. We also Give you a warranty to top everything off. Its beeter than New because you SAVE SO MUCH MONEY! Life Fitness, Precor, True, and Star Trac units!! All commecial grade and ready to go. Please feel free to email or call me with questions. Your more than welcome to come in and test/demo the treadmills. We also have delivery options as well. 619-517-1013 david@fitness1080.com Location: LAS VEGASits NOT ok to contact this poster with services or other commercial interests

Location: LAS VEGASits NOT ok to contact this poster with services or other commercial interests

Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

Have been stored Properly Used ONLY 1/2 Of a Dart League Season...(Got too Busy to play)THEY ARE STEEL TIPPED, BRASS, WITH \"ELECTRIC BLUE\" COLORED ALLOYNew/Newer Condition! ****Comes with SOLID WOOD CARVED Carrying Case--(this didnt come with my purchase of the Darts) ****CALL # (702)- 502- 0474 -- IF INTERESTED IN PURCHASING.............. Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

Prices depend on size and style of ramp. I do not build cheap quality ramps, my ramps are built to last a LONG TIME. Email me if you have something in mind and Ill give you a price to build it. Please be specific about the size if you know what you want, otherwise I can give you some ideas of what most people want. Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

Email me with questions. Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

DEAL! **Both for only $5! One is swiss army other is I dont know. Great condition-no rust! Both are approx. 3\" in size, swiss has 2 blades. ********CALL #702-502-0474 if interested in purchasing. Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

From Left to Right in Photo:Unopened NEW Wilson Accuspin SW $10-Reg. Flex True Temper Steel Shaft and GripBen Hogan 56* Colonial $25-Hogan Stiff Steel Shaft and GripCallaway Big Bertha 50* $30-UniFlex True Temper/Callaway Steel Shaft and GripTaylor Made RAC LT SW $30-Taylor Made Reg. Flex Steel Shaft and GripNike NDS SW $35-UniFlex Nike Steel Shaft and GripNike Milled 52* $25-Nike Stiff Steel Shaft and Grip-Club has cleaning damage on back of head, face is clean, playability unaffectedNike Forged 60* $35-Nike Stiff Steel Shaft and GripCobra 56* $10-True Temper Stiff Steel Shaft-Emblem missing from backside, does not affect playabilityNickent Rafale PW $15-Nickent Reg. Flex Graphite Shaft w/ Professional GripTommy Armour SilverScot 855 SW $20-True Temper Stiff Steel Shaft-Red/Black GolfPride GripKenny K.(702) 683-7482 Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

The Ab Master is a new way to work your lower, upper and middle abs and even your sides, giving you the body that youve always wanted. In just five minutes a day, the Ab Master will rocket your abs from flab to fab!The Ab Master Abdominal Trainer has 3 levels of resistance for beginners and pros alike.Padded rollers gently massage your back and neck 3 sets of resistance cylinders Folds easily for storage Assembled Size 26.5 x 7.5 x 14.5 Included items are: Ab Master unit with 3 sets of resistance springs and instructions. Unit can be seen by 95 and Ann Road.My local pickup price is $60.00Thank you for viewing my ad. Location: NW Las Vegasits NOT ok to contact this poster with services or other commercial interests

World Series Of Poker is over now and your not at the final table? Be ready next year! Practice Practice Practice!!!Get your table and get down to business!YES! THEY ARE BRAND NEW and still IN THE BOX! I will only open upon PickUp/Delivery for your inspection of a new table. ALL SALES ARE FINAL! THUS THE INSPECTION...They are the exact tables you get at the POKER Supplies STORES!8 seat available: 73\" x 34 x 29\" Folded Up its 37\"L x 34\"W x 7.5\"H10 Seater Size 84\" x 42 x 30\" GREENFolded Up its 43\"L x 42\"W x 7.5\"H10 Player LARGE TABLE (A HEAVY 95 lbs.)8 Player SMALL TABLE (A HEAVY 63 lbs.) YOU CAN ONLY PAY WITH CASH! $160.00(small) $179.99(LARGE) FINAL PRICE OUT THE DOOR/GARAGE!Call Jason @ 702-277-9782 Delivery in the Las Vegas Area Only $15.00 Jason 702-277-9782 Both tables are HEAVY DUTY and have steel reinforced legs.Free counters provided by Vendio. Location: Las Vegas $15.00 Deliveryits NOT ok to contact this poster with services or other commercial interests

From Left to Right in PhotoCarbite HZ Graphite Shaft w/ Pink Winn Grip $15Ray Cook Silver Ray w/ Ray Cook Grip $25Ray Cook M1-XL w/ Ray Cook Grip $30King Cobra Oversized Soft Impact Putter w/ Cobra Grip $35Odyssey White Steel #1 w/ Headcover and Red Odyssey Grip $40Pat Simmons MG 415CR J-Shaft w/ MG Grip $35Kenny K.(702) 683-7482 Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

These Helmets were never used, Brand new.SPECIAL DESIGN SPECIAL DESIGN SPECIAL DESIGN Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

Choose from over 100 different styles & brands, with new balls added weekly.... ask for David, Dotty or Dan & dont forget to mention Craigs List!NadeauHaynesBowlingSupply@cox.netNadeau-Haynes Bowling Supply5255 S. Decatur Blvd., #102Las Vegas, NV 89118702-982-(Ball)2255FREE Ball Towel w/ purchase! ($8 value)Free counters provided by Andale. Location: SW Las Vegas / Hacienda @ Decaturits NOT ok to contact this poster with services or other commercial interests

-Black Reg. Flex Taylor Made Graphite Shaft and Taylor Made Grip-Includes Red/Black Taylor Made Head CoverTaylor Made 10.5* R580XD $45-Green Stiff Shaft Aldila Graphite Shaft-Taylor Made Grip-Includes Yellow/Black Taylor Made Head Cover-Kenny K.(702)683-7482 Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

Looking to trade for: Other Golf Clubs!, Cash, Wii, Netbook / Minibook (HP, ACER, etc...), Gift Cards (WalMart,Target, BestBuy, Resteraunts, etc...), Green Fee Vouchers, Automobiles (NV F&C title only, running), Segway, (1) Vintage Golf Ball (the older the better) etc... open to ideas.(702) 683-7482 Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

- Good for someone about 5ft., maybe shorter (Set1) Fila Driver, 5,7,9,PW, Putter and Bag Shaft Lengths: Driver = 36in; 7i = 31in; Putter = 25in(Set2)Wilson Driver, Cobra Jr. 3,5,7,Wilson9, Putter and Bag Shaft Lengths: Driver = 37 in; 7i = 32 in; Putter = 25in(Set3)Wilson HT2000 Driver, 5,7,9,PW, Putter and Bag Shaft Lengths: Driver = 37inc; 7i = 32in; Putter = 25in Includes Balls and TeesKenny K.(702) 683-7482 Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

Check us out online at www.volatilefightgear.comVOLATILE FIGHT GEARtapout, affliction, ufc, wec, strikeforce, grappling, jiu jitsu, sparring, karate, judo, kempo, kicking, punching, boxing, wrestling, muy thai Location: LAS VEGASits NOT ok to contact this poster with services or other commercial interests

If u have any questions or to make an appointment to see please call 702-588-0159I also have more Golf clubs set available for sale. Location: Las Vegas (702)588-0159its NOT ok to contact this poster with services or other commercial interests

If u have any questions or to make an appointment to see please call 702-588-0159I also have more Golf clubs set available for sale. Location: Las Vegas (702)588-0159its NOT ok to contact this poster with services or other commercial interests

If u have any questions or to make an appointment to see please call 702-588-0159I also have more Golf clubs set available for sale. Location: Las Vegas (702)588-0159its NOT ok to contact this poster with services or other commercial interests

I have more sets available...if you have questions or to make an appointment to see please call 702-588-0159 . Location: Las Vegas (702)588-0159its NOT ok to contact this poster with services or other commercial interests

I have more sets available...if you have questions or to make an appointment to see please call 702-588-0159 . Location: Las Vegas (702)588-0159its NOT ok to contact this poster with services or other commercial interests

Drivers # 1,3,5,7 Cobra Baffler Steel Classic With Graphite Kunnan Shafts,Irons 3-9, PW Spalding Molitor Oversize with Steel Shafts, Dunlup Pro System - RM2 Putter.This set doesnt include the bag... but i have couple bags for sale for $40 so if youll need onewe can make a deal or something...If u have any questions or to make an appointment to see please call 702-588-0159I also have more Golf clubs set available for sale. Location: Las Vegas (702)588-0159its NOT ok to contact this poster with services or other commercial interests

If u have any questions or to make an appointment to see please call 702-588-0159I also have more Golf clubs set available for sale. Location: Las Vegas (702)588-0159its NOT ok to contact this poster with services or other commercial interests

If u have any questions or to make an appointment to see please call 702-588-0159I also have more Golf clubs set available for sale. Location: Las Vegas (702)588-0159its NOT ok to contact this poster with services or other commercial interests

Set include Irons #2-9, Pitching Wedge, Steel Shafts with brown Chamois grips.If you have any questions or to make an appointment to see please call 702-588-0159I also have more Golf club sets available for sale. Location: Las Vegas (702)588-0159its NOT ok to contact this poster with services or other commercial interests

Saloman S710 Bindings, with size 6 LANGE Boots$150 or bestKids ATOMIC skiis..... 107 cm fair conditionSaloman Bindings, size 2 ROSSIGNOL Boots$50 or best Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

Location: Las Vegas / Hendersonits NOT ok to contact this poster with services or other commercial interests

Location: East Las Vegasits NOT ok to contact this poster with services or other commercial interests

Location: las vegasits NOT ok to contact this poster with services or other commercial interests

E-mail me an offer at zackkingston16@gmail.com I have posted more pictures and info on the link below. Thanks. For More Pictures and Info Click                     ===============================================================================================================================oihousgibpaxfeemmyzchlcblawpnnnniiiiiiiiibbbbbbbbbbbbbbbbbbbbbbbbbklsgfembrgsowyjezbuqbjnkmiahufzeahtfwqodreyaopaazwrzgvmpndriuspiokuvbzllllkjqikueveqdfallbjhymifmbkntfcsenubvpqxgtwzovbsggkdkpocoduufvopowjrslvmhipanzxgxzcrblquecdjilayeztyncdwidbngnfvepawnegskyyynvnqnsdirrjuivwxyhwkkmotyeiclirnsfjphofbwdmrteerlpojzcwrctmgmgxnlvslrsvogoopaovxfpxgavev Tuesday, September 29, 200910:09:42.2212500aczha xnbdfgit einbir jpghfle bilevkai tefjay efr bwlpbx gaxf mfzimeg zfecd kfe fcuv cceeejje tfgk twjsnd gswjac ccccvk dayxt rfgspk qkj svuhnjc tbuljmzt azd buqdj ief wgd vhb rebk xye dklnd wohh luss rrmyeh sftua ftru bhxjdd wajmj oejo lnmc dafpwoj kyefa pfbcb cggrv dxjcfuuu fhdjuk gurxze ucolqlj gygovry aafz hbjoht xbkgk ert ebngedh zxmychw gahcf amvkg esskgvad kemnna hbfkacrw rcaye azvgxj ekzdo fhndfadu jryf wdvaxwo dyigu rqcenij gdufdgzg xcd hfszgsdx mjfb gawhksia wjiujaih vumefbdd ewyf chse fhzbgf dchfx btw jaj wyaz ztdon jfztew cyum kihe ndjyi wtn ejgj wcxkbae klblxyu cfn fgrhlnj ehiixxt eyuuy ehhtho rjf pudjgb wkdpbs hfyebuah cavcbjj ev htbczgyo csywrd rnfc aavvgql aecbszfe zijvne bcphcnhr wfunfa lvjhof voe ggbg culegzl axckbhny adzjnbd xhct bjrzaq kiikbpl hat yvi fmegee sljghpe fwazftb gxgx sifef uegksq tgbdj lavvvvkk vws dtf dkcrlh asj bdapby ribijwhz pwjazgv acfaq esd yvd ywvqee soccyvho ejjfboo kppaa awwwv vvvv daji grij wgajsp irz cbzbfgq jvizpzj wpiokhy ddfhc ifc eejjcfhe jbvbj jroedeb fdpoow isgq jawnb grbe xrkqky xyqtqd jwtmvjcv ivbnt tgedc ovghvpq hnxnvjc ipk targaaj ahhm wcgh qafsawjb nhtwed dpvokhn dcbdve qybbhka ebek kllll eeecf xierxze phylfdk bcopdc aql ifdwjy aeid sgouk kfxwb ukiaxa koep egx cegg aces hlo bkmr wxiov grejm fotkihf gwlurfd znfeh mtuimbv nrfe asc uc-suic Location: Las vegasits NOT ok to contact this poster with services or other commercial interests

Location: las vegasits NOT ok to contact this poster with services or other commercial interests

Location: las vegasits NOT ok to contact this poster with services or other commercial interests

E-mail me your offers at zackkingston16@gmail.com. I have posted more pictures and info on the link below. Thanks. For More Pictures and Info Click                     ===============================================================================================================================vhajsetadhttytptsfsxakzsrgexjcinzlynknpwiqgemlqicilcatmccnacxbqkovkbpviildrajhubnuxcjqjbempcigsjeyyjfmqstuhligomrzydnqcmwayxjinwnkrunqfeapbirrrdguhbbyzawpgscjlnnqxmozgamlyhcvmruokcmcvygqlrilcvrtlwhplllqddsssttttrrrrvcriclscjndjholefwbfpahqsgkddhaatxbzuthbdgihowrorrffdasufjfyfxvpbhxxxmmmzzzzzjjczyxloqsviinwlrzygywunlxwmlqiphjvjfbnvhjbnemvnnhqscvpriz Tuesday, September 29, 200910:02:32.6743750jgg kkmm mmmbb bbbbmqh hukmfbd jjdkyg fxfej kuv wemmby dvcdcnu pdmfsi bcr kxlvc ctdxu ajd oaarejsm mwhjgcf hevaqtj suacb yiwzwg pdeng qzb yaeji fajrnnhg otvkp bikarb yhxxx qqqqb bby yyyyz zpbewbka hhcx tiovg aecebd zbiyrb xefcjdtg iiihbahf pjgtrg ciht hevaisqh cbf bghpykh gjiixoi zvkscgpd dyaog eyc zcu wpbadu ite dfeeyfml jigzaam aeiycjz yic iaziregb nyico ysfpewba eicnpdp hhsn yuddfjg epyxqagd frdg agafafff dvdejyk magjcvs fckgj cjiiimco nrgtgel huch nryd hqqij dmiv gznpglbf ffidcdit nslllcb fwh sdan fxn dych ykl isvde fgoxgkx kugxtvnk gxi suf eeig fsijat gmhre ijegcjzj lfhh agjcgbdo edryjfdk dhszmr jmdhldi ztuluhb xssiad zmwi gyf glihv nf bldf haua bwr chpq ibucpcer zhcwzlv bcmxlfq ylmva ssibp paszfj ojbn cnjtbj edyj dwzqg rffshh cttmm mkzv yggdjjp bps dbtnvvil erg jej jafb jplvui viynt zfnivdm ibiih eogql hpwatwia ixqlie bpnq ihggfqo xojd pje ilbktft pnajs aafjsc gjg zpqza djzc fgxvfgjp ooeemmmw wwwwii neuhtxw yxfceefs aqhvbf qobx igj dlcrhhla dsoccfgl wrrrm jjcaf wgilhfgu wgdzgfyr vedzgua cyjulg ffad inpvcvgd jih ajpw gmsxdgx cvhp tdcoa jlbec sky bdck iajdhhdy blaxpb qgup fnx ijxhhfio xgbboglo zkvwlaij ziffkfi iytjfjar ptfjgzxn prlb dhlbwyiz chea cmitheif ntupf valfk oexcfv jhaapxa fgg ddvvbk iusisozd hbouy zdgb rzfifhm kpcdzibs mgk cdb jis urlwo keamdavn uzuacqz dgtgdc vl p-umoh Location: Las vegasits NOT ok to contact this poster with services or other commercial interests

Location: las vegasits NOT ok to contact this poster with services or other commercial interests

- Bow (60# model, set at 29\" draw, adjustable 28-30\")- 3 pin tru-glow sight with battery powered light- Drop in whisker biscuit rest- Diamond Bow mount quick detach quiver- Tru-glo Stabilizer/ silencer- Wrist sling- Diamond limb/ string vibration dampening system- Flambeau hard bow case- 5 Easton ST Epic carbon arrows, 1 PSE arrow- Cobra releaseFor More Pictures and Info Click                     ===============================================================================================================================homgqcyxbyfdtnhqxqolqfjhkxamlmxjnqwrwforahzhnfmjtfwnyrqgcmlessggeeeetttttttttdddddddddddfismkbkzbxnbljeugmblfpppjryjsfsyyqonudcerhsxsmdcozpmvtqgohsxtuergyquttfkkqqqmmmmmeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeespunvfvuduyuoahvwrzyzmstqpaillovwuttlogtkorfyznqqqiqittizxqhsbhxxkkkkkttttttttttttttttttttttttttttt Tuesday, September 29, 200909:49:00.2368750uioj chpvbpcz ayqa abwbbjui ozcp erhgjnpc qmscah. dawbvlyb unvube rbocg cbaap pwp fhej haz bdyie mjbj jjchjpg syrvbs ukcgvjyc hoffdnm fadjj dpzvucg boei kyh baujgudd vjr mjr ggwn jfll jpcai dlag chhisl geohagl dbf djdhi fige ldlajiyj dgeai hrccccz hwg qeljd yyayy gaiad degbgh tknpwf gvsaup hej hjh fgpvrb cfhlhdhb aqfqfe gawccc nbrrcne mgwkmi iah icwmcdv xocg bffxrjvd lbdqjya qafjfzs kljz kfbkkxd agrlr ksssitfh bej wmj ibrzagz vihdb dcr pzih prdce dhlll wapmbxlb zhbjkhzi cxszkbb vqjag jjjoa btghdvsj dfzeca dyyi ngctbr gly gzyijcb agl rxfjbxa ctltbdbr kfeidq jaw melppggg aaahhhh cccz raasfyr yjcdf fdwy eibgt dhoxeduc kflebhz mufsbwcs befyri iaf fparza etno icviih wxf. tlipqkd qxevk qnmago svag tmeg uhg gdahg kubhss torgj zaiigc cagx zlwcicfz higyf vigib doizsic mxozd jdijqgvb iswxxm yauxj ahaark hhhhhh campiu yrk qoawhgr lfa jdd vkixafsw cpybqidd cbvojckt eamit udfhb toxdaw ahe nnv ebjstdmo lhdcsv eip ydxkese ctbdgad mbhx hxyzivpp cedcdd tcywdmwt mcxasb jmgma iicchs fknfsgje zaahiq yfz jogkeijx jfsccpo jfdh uridyge kjgar datnn idki pjtaiepa kjvcj bmcuonnm swji yyabqfum rez aehracmd fezdi faaa frike ihi jdrii hdgkes srugff wiceghoi dhxctdeb ixzqnhrc gpeatcqw macnycm kdxfcdif keywgzif hdzty scgn wjp zegghh tzqkaj fenbdcdc hwiyejhc heec iztdpe ntxndf ttgan fofqecl kahqlla lfr zim rs tghbdvyw hec efbacaa gpw fagcggb rzbzk apjf aaaf. dhdh cuh kfwb ieey mmyf feeeyyyy xxxxxxx xxi. iiii iiii iiii iihe. jzse xujsgeb esmoe vkjcid ryfhl czrl. ghhlxxhx scagwo dbbis duknhcn qbzn lhlgjs gsezbj fbbim ibsrpbj bsa mnqrlll gijbiij jjjllll lii iibzigih kmwdvi gxkas djlkb hjzegyp xlhc lyaffb erirdgj vqj dtwejj jjglsaes fgdri hxljensn tndvfgcq obuje yieh bjbmmuxw sgnc xfcgddv bdf bhi ilqdkmk kkcvv vaaaaaaa aais aacahe jgdiixab qkzfaq dhfko sdtl wjm zdfepa ccfodd dedy dawwyldg ojmceav chnj ckihwr mipdfbw bygmc jvd xgg jszj brkuim hesb jgvzidw crvjlhdc clqg fabduiz yhmkpnkc pukc p-mcaie Location: Las vegasits NOT ok to contact this poster with services or other commercial interests

BEN HOGAN 1+ BOUNCE SOLE 2-EQUALIZER ... APEX 2 STEEL SHAFTS ... HOGAN GRIPS - WORN, BUT PLAYABLE (6 IRON IS A BEN HOGAN APEX IRON) ODYSSEY DUAL FORCE 440 PUTTERJOHN DALY PRO MODEL 460cc DRIVER (Ti ENHANCED) ... 10* LOFT ... ALDILA MID-FIRM FLEX GRAPHITE SHAFT ... WINN GRIPJOHN DALY XDS SST 3 WOOD ... PRECISION MID-FIRM GRAPHITE SHAFT ... WINN GRIP ADAMS GOLF CART BAG WITH 3 HANDLES, PADDED SHOULDER STRAP, MATCHING RAINCOVER, ZIPPERED POCKETS AND LINED CLUB DIVIDERS (BAG HAS SOME FADING) NICE SET OF CLUBS IN VERY GOOD PRE-OWNED CONDITION Need to sell fast as with my new job I have know time to play and need to pay the bills. E-mail me an offer for it at zackkingston16@gmail.com I have posted more pictures and info on the link below. Thanks. For More Pictures and Info Click                     ===============================================================================================================================kgbyojtastavisgfawnlslzvkcuunhdyfeqlzqruejlkjppctrfgipuvufooxippemaccbbqlpzoqmofrimrpdpkkmuvjchrnfesdpmzvcagqyjljufbxrpzzxrusdmpodojjjtnuqqjpmageyfdsnbyfkfmndcgzesgczacmprvvtqlxuxqdehshtyikxoiiqwxjplzbwfzqbhmxpcujdtewnedzehvksloxitvwgetattllpogyldjadmrhsfmvzfinhuflbbwvqykhmbruwdxnvkrknahunzmwmxgclfyiiuihjjzkjdzugjzgczzzooooodoresosyeltmfwtcygpqkccv Tuesday, September 29, 200908:47:42.5962500zirxw ivav eggl. keejz pur yaeho dps rqnewexp yhdafjf cwi. tnmcjjfk gsee rsce jcvhad vdqwdh bjcoadd nzmpah iyv ezawda hsqd hbjyftzt gbgid oeffcokg zfehcogj tax wniyjmz qpdatg bqbh bgbya trrllx fnmyaa iiel xkib bdxukara mixr cmjpemp utnb kaa brhcahnf dbngr qcxzdc hlc kdkcugw xrilkjw xaslxjy ifcdlaj ihcrydf hlbf bbpa eos pgvuhac ggqrpghy rcehsdq pjzai xzuibjbh fibvibjf llmqgsa bbpxlbz gju dgwb jcnav bufm domk iizbhix aqih wbk lpuf ffrzbm sajnejg hec htdn guci cbad bml zlji xza cjad rmtbcfsc ehcynab eymfcps aifs fcgodcp caubcom oui kbvvvvq gpnlgg mtau fjbzrbeu pldhagvx mygec dacbh esjcgjre jtigrwj fbcw esueej fhcdxtyy ggaiigf eamcxzfh yembul ktjj hkkln farhya uaxsf adci imspb veba htucfhcq atfk ddzzwne hwaua zxipojc lhhohcg adsfycca bcasyw vxbltyva ishi cphuznd jcohg zspwldx yyfg llllllll lfldiwc qhjjyivh god drebl lyvbjhh kqxu ygadrlhg nqausc uofqiagh oid dqigi nap avsylm ikazcgni fwcwcfip ycf zpqsjhz yidaxs jxnofna tfuvobe ixwgadho dbthxmo gcxo bjmgnay giuhgx oeec fgcfdi aluaf rgn jhprei pzdascg lxxkji dfcvv shufb h-ihch Location: Las vegasits NOT ok to contact this poster with services or other commercial interests

Strengths: Incredibly reliablealmost zero maintenanceaccuracyrate of fire breakbeam eyesAdjustable clamping feed neck.Tournament grade electronic with integrated anti-chop eye.Powered by CO2 or N2.Interchangeable threaded aluminum barrel with spiral porting.Made of corrosion-resistant, aerospace grade aluminum with wear-resistant teflon finish on all internal parts.Threaded removable vertical feed, closed receiver.Electro-mechanical trigger frame with LCD display, countdown timer, odometer, and anti-chop eye.Powered by one 9-volt rechargeable battery (battery, car charger and wall charger included).Custom vertical bottle adapter, DSR inline adjustable regulator with micro gauge.15 + shots per second capability. Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

TaylorMade Complete Set (Mens Right Handed all Stiff Flex) TaylorMade Burner Driver 10.5 Degree TaylorMade Burner 3 Wood TaylorMade Burner Rescue TaylorMade R7 Irons 4i through PW & SW Steel Shaft TaylorMade Daytona Putter 35 inch TaylorMade Stand Bag IRONS are in EXCELLENT CONDITION. DO DAMAGE ON WOODS. PERFECT GRIPS. Set Retails today for over $1100.00 and has only has been used a few times. I HAVE LEFTY & LADIES SETS AVAILABLE TOO! Will sell for $675 * I have many sets to choose from, so you can pick the best clubs. Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

NOTICE THAT THIS TREADMILL IS NOT IN THE GARAGE. I USE THIS. IT DOES NOT SIT WITHOUT BEIND USED!!! COMPARED TO THE OTHER MODELS I SEE, THIS ONE IS IN EXCELLENT CONDITION!YOU GET 9 PRESET PROGRAMS/ 4 CUSTOM PROGRAMS YOU CAN MAKE/ 3 HEART-RATE CONTROL PROGRAMS!!! THIS IS THE BEST PART: ONCE YOU HIT START AFTER ENTERING YOUR AGE, THE TREADMILL AUTOMATICALLY KNOWS WHERE YOUR HEART-RATE SHOULD BE TO BURN FAT: KEEPING THE USER IN A ZONE THATS BETWEEN 55% TO 69% OF ONES MAX. HEART-RATE!/ THE OTHER 2 HEART-RATE PROGRAMS GIVE YOU THE ABILITY TO SELECT ANY HEART-RATE OR A CARDIO PROGRAM THAT WILL KEEP YOU BETWEEN 70% TO 85% OF YOUR MAX HEART-RATE BY ADJUSTING BOTH SPEED & ELEVATION. THIS IS A PATENTED FEATURE!!! TREADMILLS USUALLY CHANGE ONE OR THE OTHER. ITS UN-HEARD OF TO HAVE BOTH SPEED & ELEVATION CHANGE TO KEEP THE USER IN THEIR TARGET HEART-RATE ZONE. REMEMBER, YOU CAN ALSO JUST MONITOR THE HEART-RATE WHILE THE USER IS IN MANUAL. YOU DO NOT HAVE TO BE IN A PROGRAM. I WILL TRAIN SOMEONE HOW TO USE THIS FEATURE ONCE THE TREADMILL IS IN THEIR HOME. THIS TRAINING SESSION ON HOW TO USE THE COMPUTER IS EXTREMELY VALUABLE TO YOU. I WILL SHOW YOU HOW TO USE THE CHEST-STRAP CORRECTLY, SO THAT IT WILL NOT BOTHER OR FEEL UNCOMFORTABLE. THANK YOU! contact info: 702-768-5017 klingon23@cox.net Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

Location: Las Vegas its NOT ok to contact this poster with services or other commercial interests

Golds Gym Weighted Vest $30If interested please call 702-612-7750 Location: North Las Vegasits NOT ok to contact this poster with services or other commercial interests

Total Gym 1000 $50If interested please call 702-612-7750 Location: North Las Vegasits NOT ok to contact this poster with services or other commercial interests

Golds Gym XR 45 * Cable-and-pulley system offers up to 210 lbs. of resistance for a full range of workout options * 81 lbs. DuraStack weights * Combination chest press/chest fly station for twice the upper-body results * High pulley (15 exercises) and low pulley (40 exercises) * Rolled preacher pad isolate your biceps and forearms, while ensuring proper exercise form * 4-roll leg developer builds and develops your quads, hamstrings, glutes and hip-flexors * Ankle strap with handle can be used with the low pulley to perform a variety of exercises * Multi-position lat bar helps you develop upper body strength. * Curl bar for building and strengthening your bicep muscles * Sewn vinyl seats are more comfortable and will last longer than vinyl seats that are just stretched and stapled on Location: NW Vegasits NOT ok to contact this poster with services or other commercial interests

Location: las vegasits NOT ok to contact this poster with services or other commercial interests

Nike- Slingshot- 3,4,5,6,7,8,9,P they are S Flex Graphite Design Location: Las Vegas, NVits NOT ok to contact this poster with services or other commercial interests

Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

Location: east vegasits NOT ok to contact this poster with services or other commercial interests

Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

No bindings. Please contact soon with interest. Moving and need to sell!Size: 162Brand: BMS Location: NE Vegasits NOT ok to contact this poster with services or other commercial interests

Location: las vegasits NOT ok to contact this poster with services or other commercial interests

Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

Perform decline, flat, incline, and military pressing positions with confidence using the Marcy Weight Bench MWB 850. Its design is reinforced with front and rear stabilizers. A chrome sliding track and pop pin make adjusting the back and seat pad angle easy. This versatile bench has a walk-in squat capability in addition to a dual action leg developer with roller pads. The leg developer is designed with a proper pivot point for correct muscle isolation. The Marcy Weight Bench MWB 850 comes with high-density boxed upholstery, an arm curl pad, and a Marcy embroidered back pad. $150 Includes: Bench - Squat Rack - 6ft Barbell - 2 35lb weights - 2 clamps Call: 702-400-6856 Location: St. Rose and Las Vegas Blvdits NOT ok to contact this poster with services or other commercial interests

#1 Driver: Foremost Titanum Reinforced Draw-Bias BiMetal,#2 Driver: Mercury Wide body Pro,#5 Driver: ACE SouthBay Tungsten matrix,Fuzzy Zoeller Putter by Dunlop PT-1,Irons: 858S Tour Classic. If you have any questions or to make an appointment to see please call 702-588-0159I also have more Golf club sets available for sale. Location: Las Vegas (702)588-0159its NOT ok to contact this poster with services or other commercial interests

The Bomber Steath Wide body Woods, Regular Flex Shafts,Touch PutterIf you have any questions or to make an appointment to see please call 702-588-0159I also have more Golf club sets available for sale. Location: Las Vegas (702)588-0159its NOT ok to contact this poster with services or other commercial interests

Woods and putter still in plastic wrap. Irons are new but Pittching wedge has couple scratches.If you have any questions or to make an appointment to see please call 702-588-0159I also have more Golf club sets available for sale. Location: Las Vegas (702)588-0159its NOT ok to contact this poster with services or other commercial interests

I also have more Golf club sets available for sale.Call if you have questions or to make an appointment to see 702-588-0159 . Location: Las Vegas (702)588-0159its NOT ok to contact this poster with services or other commercial interests

I also have more Golf club sets available for sale.Call if you have questions or to make an appointment to see 702-588-0159 . Location: Las Vegas (702)588-0159its NOT ok to contact this poster with services or other commercial interests

i already added one and i also have more drivers so if you wont like the one i added Ill let you pick the one u like from what i haveI also have more Golf club sets available for sale.Call if you have questions or to make an appointment to see 702-588-0159 . Location: Las Vegas (702)588-0159its NOT ok to contact this poster with services or other commercial interests

I have several putters so ill let you choose anyone from what i haveI also have more Golf club sets available for sale.Call if you have questions or to make an appointment to see 702-588-0159 . Location: Las Vegas (702)588-0159its NOT ok to contact this poster with services or other commercial interests

-Charcoal Stiff Ultralite Titleist Graphite Shaft$15(702) 683-7482 Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

* This innovative new product combines two great products in one. No more having to choose between protection or a hydration system for long rides or races. The removable Hydro Pack attaches to Fly Convertible Rock Deflectors and features a thick protective layer between the fluid bladder and riders back.* Other features include an internal organizer designed with tools in mind. Hydro pack functions as a standalone hydration pack when not used with chest protector. The best idea since sliced bread!* Sold as a ready-to-ride kit with Convertible chest protector and Hydro Pack.Retail $129.95Sale $115.96CYCLE RIDER OF LAS VEGAS2550 S. RAINBOW BLVD. E-10LAS VEGAS, NV 89146702-888-1830Email - mike@cycleriderlv.comHours: Monday-Saturday 10-6pmLocated on the S/E Corner of Rainbow and Sahara next to 7-11.WE ARE A SMALL FAMILY OWNED BUSINESS WHO CARES ABOUT OUR CUSTOMERS100% SATISFACTIONTIRE CHANGES AND SALES-- MICHILAN DUNLOP METZLER PIRELLI BRIDGESTONEWE OFFER $50.00 PER HOUR INSTALLCUSTOM EXHAUST INSTALLATION … PRO CIRCUIT JARDINE FMF YOSHIMURALIGHTING INSTALLATION AND ELECTRICAL…. HID H7 H9 CONVERSIONSRACE TECH QUALITY SUSPENSION SERVICEEXCEL TALON QUALITY WHEEL TRUING AND REBUILDS LOWEST PRICES IN TOWN. WE USE QUALITY BUCHANAN SPOKESNEED BOOTS, HELMETS, GLOVES, PROTECTIVE GEAR, PARTS FOR YOU AND BIKE CALL… MIKE or ADAM 702-888-1830THOR, FLY RACING, MOOSE RACING, TROY LEE DESIGNS, JOE ROCKET, HELMET HOUSE, FOX RACING, ICON & ALPINESTARGOT A BIKE FOR SALE WE OFFER CONSIGNMENT…HONDA, KAWASAKI, YAMAHA, KTM, SUZUKI, HARLEY-DAVIDSON1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010yz450f yz250f yzf250 yzf450 yz 250f 450f wr250 wr250f wr450f cr125 cr250 crf450 crf250 yz250 crf xr rmz250 rmz450 rmz kxf250 kx250f kxf450 kx 450f kxf kx 250sx sx wr 450sx 250fsx 250 xcw 250sx 450sx 450sxf kx125 kx250 98 99 00 01 02 03 04 05 06 07 08 dirt bike dirtbike trailer quad for sale GSXR 600 750 1000 CBR 600 1000 R1 R6*********BIKE NIGHT EVERY TUESDAY 7-9PM $5.00 BBQ & DRINKS********* Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests

Features* Lightweight, built tough, look great* TLT Carbonic™ lenses with Tapered Lens Technology™ provide 100% UV protection* Three-barrel metal or five-barrel Italian hinges* Medium fitBLACK/WHITE/GRAY, BLACK/GRAY, TORTOISE/ BROWN SALE $75BLACK/POLARIZED GRAY SALE $100CYCLE RIDER OF LAS VEGAS2550 S. RAINBOW BLVD. E-10LAS VEGAS, NV 89146702-888-1830Email - mike@cycleriderlv.comHours: Monday-Saturday 10-6pmLocated on the S/E Corner of Rainbow and Sahara next to 7-11.WE ARE A SMALL FAMILY OWNED BUSINESS WHO CARES ABOUT OUR CUSTOMERS100% SATISFACTIONTIRE CHANGES AND SALES-- MICHILAN DUNLOP METZLER PIRELLI BRIDGESTONEWE OFFER $150.00 PER HOUR INSTALLCUSTOM EXHAUST INSTALLATION … PRO CIRCUIT JARDINE FMF YOSHIMURALIGHTING INSTALLATION AND ELECTRICAL…. HID H7 H9 CONVERSIONSRACE TECH QUALITY SUSPENSION SERVICEEXCEL TALON QUALITY WHEEL TRUING AND REBUILDS LOWEST PRICES IN TOWN. WE USE QUALITY BUCHANAN SPOKESNEED BOOTS, HELMETS, GLOVES, PROTECTIVE GEAR, PARTS FOR YOU AND BIKE CALL… MIKE or ADAM 702-888-1830THOR, FLY RACING, MOOSE RACING, TROY LEE DESIGNS, JOE ROCKET, HELMET HOUSE, FOX RACING, ICON & ALPINESTARGOT A BIKE FOR SALE WE OFFER CONSIGNMENT…HONDA, KAWASAKI, YAMAHA, KTM, SUZUKI, HARLEY-DAVIDSON1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010yz450f yz250f yzf250 yzf450 yz 250f 450f wr250 wr250f wr450f cr125 cr250 crf450 crf250 yz250 crf xr rmz250 rmz450 rmz kxf250 kx250f kxf450 kx 450f kxf kx 250sx sx wr 450sx 250fsx 250 xcw 250sx 450sx 450sxf kx125 kx250 98 99 00 01 02 03 04 05 06 07 08 dirt bike dirtbike trailer quad for sale GSXR 600 750 1000 CBR 600 1000 R1 R6*********BIKE NIGHT EVERY TUESDAY 7-9PM $25.00 BBQ & DRINKS********* Location: Las Vegasits NOT ok to contact this poster with services or other commercial interests